styling gel

Save up to 20% on select brands now through 5/13! Shop Here!

(41 Items)

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 14.80 True False False False 14.80 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

On SaleLog in to view pricing!
View Sizes
109756 491424 491424 1 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagssupremedefininggel12oz.jpg Bonus Deal Available 17.80 17.80 14.80 True False False False 14.80 False False Diversion contract is required 0 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler previousl Arc AnGel Gel provides definition without the crunch. True Log in to view pricing! False

DevaCurl
SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler

On SaleLog in to view pricing!
View Sizes
109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 17.80 17.80 14.80 True False False False 14.80 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

On SaleLog in to view pricing!
View Sizes
121131 420055 420055 1 Styling Gel 17 6 Fl. Oz. Kenra Professional Kenra Professional Styling Gel 17 6 Fl. Oz. False kenraprofessional/2419764KenraProfessionalStylingGel6floz.jpg Bonus Deal Available 10.00 10.00 7.50 True False False False 7.50 False False Diversion contract is required 0 Kenra Professional Styling Gel 17 designed to create versatile looks. True Log in to view pricing! False

Kenra Professional
Styling Gel 17

6 Fl. Oz.

SKU 420055

On SaleLog in to view pricing!
Quick View
70901 119045 119045 1 Maximum Volumizing Solution 8 Fl. Oz. LOMA LOMA Maximum Volumizing Solution 8 Fl. Oz. True loma/lomamaxvolumesol8oz.jpg Bonus Deal Available 11.00 11.00 7.70 True False False False 7.70 False False Diversion contract is required 0 LOMA Maximum Volumizing Solution is a volume building styling solution for medium to firm hold. True Log in to view pricing! False

LOMA
Maximum Volumizing Solution

On SaleLog in to view pricing!
View Sizes
147266 498019 498019 1 GEL 5.07 Fl. Oz. STMNT STMNT GEL 5.07 Fl. Oz. False stmnt/stmntgel5oz.jpg Bonus Deal Available 10.98 10.98 9.00 True False False False 9.00 False False Diversion contract is required 0 STMNT GEL is a classic hair gel with a statement-making twist thanks to its unique formula with charcoal for a satin finish without flakes. True Log in to view pricing! False

STMNT
GEL

5.07 Fl. Oz.

SKU 498019

On SaleLog in to view pricing!
Quick View
55477 595378 595378 1 Frozen Gel 5.3 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Frozen Gel 5.3 Fl. Oz. False alfaparfmilano/mj18alfaparffrozengel53floz.jpg Bonus Deal Available 12.00 12.00 12.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Frozen Gel is a gel for extreme ice-effect looks. Crystallizes and sets the hair style. A perfect look for 8 hours! True Log in to view pricing! False

Alfaparf Milano
Style Stories Frozen Gel

5.3 Fl. Oz.

SKU 595378

Log in to view pricing!
Quick View
55471 595376 595376 1 Texturizing Gel 5.07 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Texturizing Gel 5.07 Fl. Oz. False alfaparfmilano/mj18alfaparftexturizinggel507floz.jpg Bonus Deal Available 12.00 12.00 12.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Texturizing Gel brings structure to the hair fiber, for defined and malleable results with a natural effect. Suitable for all hair types, even to enhance natural drying. True Log in to view pricing! False

Alfaparf Milano
Style Stories Texturizing Gel

5.07 Fl. Oz.

SKU 595376

Log in to view pricing!
Quick View
33859 795067 795067 1 LUXE CRÈME GEL 5.1 Fl. Oz. ALTERNA Professional ALTERNA Professional Caviar Anti-Aging Professional Styling LUXE CRÈME GEL 5.1 Fl. Oz. False alternaprofessional/caviarluxecreamgel.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required 0 ALTERNA Professional Caviar Anti-Aging Professional Styling LUXE CRÈME GEL is a high-hold crème gel that shapes and transforms the hair while providing natural shine. True Log in to view pricing! False

ALTERNA Professional
Caviar Anti-Aging Professional Styling LUXE CRÈME GEL

5.1 Fl. Oz.

SKU 795067

Log in to view pricing!
Quick View
143038 795146 795146 1 MY WAY CURL DEFINING GEL 5 Fl. Oz. ALTERNA Professional ALTERNA Professional My Hair My Canvas MY WAY CURL DEFINING GEL 5 Fl. Oz. False alternaprofessional/alternamyhairmycanvasmywaycurldefininggel5oz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required 0 ALTERNA Professional My Hair My Canvas MY WAY CURL DEFINING GEL is a vegan and silicone-free curl defining gel that is non-greasy and non-flaking, providing a soft but flexible hold, and humidity resistance for up to 72-hours. True Log in to view pricing! False

ALTERNA Professional
My Hair My Canvas MY WAY CURL DEFINING GEL

5 Fl. Oz.

SKU 795146

Log in to view pricing!
Quick View
51968 298044 298044 1 curl corps enhancing gel 6.7 Fl. Oz. amika: amika: curl corps enhancing gel 6.7 Fl. Oz. False amika/amikacurlcorpsenhancinggel6oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 amika: curl corps enhancing gel is a weather-proofing, curl-boosting gel that gives bouncy shape without the crunch factor. True Log in to view pricing! False

amika:
curl corps enhancing gel

6.7 Fl. Oz.

SKU 298044

Log in to view pricing!
Quick View
154595 499010 499010 1 Blow Dry Volumizing Gel 8.5 Fl. Oz. Sexy Hair Blow Dry Volumizing Gel 8.5 Fl. Oz. False sexyhair/sexyhairbigblowdryvolumizing8.5oz.jpg Bonus Deal Available 10.98 10.98 10.98 False False False False 0.00 False False Diversion contract is required 0 Sexy Hair Big Sexy Blow Dry Volumizing Gel creates volume and lift with a workable, medium hold and style memory that lasts up to 48 hours. True Log in to view pricing! False

Blow Dry Volumizing Gel

8.5 Fl. Oz.

SKU 499010

Log in to view pricing!
Quick View
565 988334 988334 1 Hydro Gel Light 5.1 Fl. Oz. Framesi BY framesi™ Hydro Gel Light 5.1 Fl. Oz. False framesi/738884262312.jpg Bonus Deal Available 7.73 7.73 7.73 False False False False 0.00 False False Diversion contract is required 0 A styling and sculpting gel that creates natural, flexible hold while adding volume and shine. Will not build up and lets your color shine through. True Log in to view pricing! False

BY framesi™ Hydro Gel Light

5.1 Fl. Oz.

SKU 988334

Log in to view pricing!
Quick View
566 988335 988335 1 Hydro Gel Strong 5.1 Fl. Oz. Framesi BY framesi™ Hydro Gel Strong 5.1 Fl. Oz. False framesi/738884262329.jpg Bonus Deal Available 7.73 7.73 7.73 False False False False 0.00 False False Diversion contract is required 0 A strong hold gel that fortifies hair, leaving no residue. Volumizes and enhances shine, lets your color shine through. True Log in to view pricing! False

BY framesi™ Hydro Gel Strong

5.1 Fl. Oz.

SKU 988335

Log in to view pricing!
Quick View
2638 528014 528014 1 Styling Gel 16 Fl. Oz. Clubman Clubman Styling Gel 16 Fl. Oz. False clubman/cl_jar_279200_stygel_hr.jpg Bonus Deal Available 8.00 8.00 8.00 False False False False 0.00 False False Diversion contract is required 0 Specially formulated for me. True Log in to view pricing! False

Clubman
Styling Gel

16 Fl. Oz.

SKU 528014

Log in to view pricing!
Quick View